Product Description
Recombinant Bacillus subtilis Probable flavodoxin-2 (ykuP) is available at Gentaur for Next week Delivery.
Gene Name: ykuP
Alternative Names :
Expression Region : 1-151aa
AA Sequence : MAKILLVYATMSGNTEAMADLIEKGLQEALAEVDRFEAMDIDDAQLFTDYDHVIMGTYTWGDGDLPDEFLDLVEDMEEIDFSGKTCAVFGSGDTAYEFFCGAVDTLEAKIKERGGDIVLPSVKIENNPEGEEEEELINFGRQFAKKSGCAV
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 32.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Low-potential electron donor to a number of redox enzymes.Curated
Function : Low-potential electron donor to a number of redox enzymes.
Involvement in disease :
Subcellular location :
Protein Families : Flavodoxin family
Tissue Specificity :
Paythway :
Uniprot ID : O34589
Euro
British Pound
US Dollar