Product Description
Recombinant Bacillus subtilis Sporulation-specific extracellular nuclease (nucB) is available at Gentaur for Next week Delivery.
Gene Name: nucB
Alternative Names :
Expression Region : 29-136aa
AA Sequence : SYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPTKPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ
Sequence Info : Full Length of Mature Protein
Tag Info : Tag-Free
Theoretical MW : 12 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Degrades both double-stranded linear and covalently closed circular DNA. Likely to play a scavenging role in order to supply nutrients under starvation conditions.
Function : Degrades both double-stranded linear and covalently closed circular DNA. Likely to play a scavenging role in order to supply nutrients under starvation conditions.
Involvement in disease :
Subcellular location : Secreted
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P42983
Euro
British Pound
US Dollar