Recombinant Bacillus subtilis Sporulation-specific extracellular nuclease (nucB)

Product Description

Recombinant Bacillus subtilis Sporulation-specific extracellular nuclease (nucB) is available at Gentaur for Next week Delivery.

Gene Name: nucB

Alternative Names :

Expression Region : 29-136aa

AA Sequence : SYDKVLYFPLSRYPETGSHIRDAIAEGHPDICTIDRDGADKRREESLKGIPTKPGYDRDEWPMAVCEEGGAGADVRYVTPSDNRGAGSWVGNQMSSYPDGTRVLFIVQ

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 12 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Degrades both double-stranded linear and covalently closed circular DNA. Likely to play a scavenging role in order to supply nutrients under starvation conditions.

Function : Degrades both double-stranded linear and covalently closed circular DNA. Likely to play a scavenging role in order to supply nutrients under starvation conditions.

Involvement in disease :

Subcellular location : Secreted

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P42983