Recombinant Bacillus subtilis Subtilosin-A (sboA)

Product Description

Recombinant Bacillus subtilis Subtilosin-A (sboA) is available at Gentaur for Next week Delivery.

Gene Name: sboA

Alternative Names : Antilisterial bacteriocin subtilosin (sbo)

Expression Region : 9-43aa

AA Sequence : NKGCATCSIGAACLVDGPIPDFEIAGATGLFGLWG

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 3.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium, A single mutation (Thr-14-Ile) confers hemolytic activity against rabbit and human blood

Function : Has bacteriocidal activity against some Gram-positive bacteria such as Listeria, some species of Bacillus and E.faecium

Involvement in disease :

Subcellular location : Secreted

Protein Families : Bacteriocin class V family

Tissue Specificity :

Paythway :

Uniprot ID : O07623