Euro
British Pound
US Dollar
Product Description
Recombinant Bacillus thuringiensis subsp. kurstaki Pesticidal crystal protein cry1Ab (cry1Ab), partial is available at Gentaur for Next week Delivery.
Gene Name: cry1Ab
Alternative Names : 130KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b)
Expression Region : 1022-1155aa
AA Sequence : HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 31.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
Function : Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.
Involvement in disease :
Subcellular location :
Protein Families : Delta endotoxin family
Tissue Specificity :
Paythway :
Uniprot ID : P0A370
