Recombinant Bovine Lingual antimicrobial peptide (LAP3), partial

Product Description

Recombinant Bovine Lingual antimicrobial peptide (LAP3), partial is available at Gentaur for Next week Delivery.

Gene Name: LAP3

Alternative Names : Leucine aminopeptidase 3;LAP-3Leucyl aminopeptidasePeptidase SProline aminopeptidase (EC:3.4.11.5)Prolyl aminopeptidase

Expression Region : 25-64aa

AA Sequence : PGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFNKLVS

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 20.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the roval of unsubstituted N-terminal amino acids from various peptides.

Function : Presumably involved in the processing and regular turnover of intracellular proteins. Catalyzes the removal of unsubstituted N-terminal amino acids from various peptides.

Involvement in disease :

Subcellular location : Cytoplasm

Protein Families : Peptidase M17 family

Tissue Specificity :

Paythway :

Uniprot ID : P00727