Recombinant Bovine Polymeric immunoglobulin receptor (PIGR), partial

Product Description

Recombinant Bovine Polymeric immunoglobulin receptor (PIGR), partial is available at Gentaur for Next week Delivery.

Gene Name: PIGR

Alternative Names :

Expression Region : 400-599aa

AA Sequence : SRGLIKEQYEGRLALLTEPGNGTYTVILNQLTDQDTGFYWCVTDGDTRWISTVELKVVQGEPSLKVPKNVTAWLGEPLKLSCHFPCKFYSFEKYWCKWSNRGCSALPTQNDGPSQAFVSCDQNSQVVSLNLDTVTKEDEGWYWCGVKEGPRYGETAAVYVAVESRVKGSQGAKQVKAAPAGAAIQSRAGEIQNKALLDPS

Sequence Info : Partial

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 26.0 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the Extracellular domain (known as the secretory component) from the transmbrane segment.

Function : This receptor binds polymeric IgA and IgM at the basolateral surface of epithelial cells. The complex is then transported across the cell to be secreted at the apical surface. During this process a cleavage occurs that separates the extracellular (known as the secretory component) from the transmembrane segment.

Involvement in disease :

Subcellular location : Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Secretory component: Secreted

Protein Families :

Tissue Specificity : Found in mammary gland, jejunum, lung, kidney and small intestine.

Paythway :

Uniprot ID : P81265