Euro
British Pound
US Dollar
Product Description
Recombinant Bungarus multicinctus Alpha-bungarotoxin isoform A31 is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : Short name: Alpha-BTX A31 Short name: Alpha-Bgt(A31) Short name: BGTX A31 Alternative name(s): Long neurotoxin 1
Expression Region : 22-95aa
AA Sequence : IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPSKKPYEEVTCCSTDKCNPHPKQRPG
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Theoretical MW : 38 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Binds with high affinity to muscular (alpha-1/CHRNA1) and neuronal (alpha-7/CHRNA7) nicotinic acetylcholine receptor (nAChR) and inhibits acetylcholine from binding to the receptor, thereby impairing neuromuscular and neuronal transmission. Blocks the extracellular increase of dopamine evoked by nicotine only at the higher dose (4.2 µM).
Function : Binds with high affinity to muscular (alpha-1/CHRNA1) and neuronal (alpha-7/CHRNA7) nicotinic acetylcholine receptor (nAChR) and inhibits acetylcholine from binding to the receptor, thereby impairing neuromuscular and neuronal transmission. Blocks the extracellular increase of dopamine evoked by nicotine only at the higher dose (4.2 uM).
Involvement in disease :
Subcellular location : Secreted
Protein Families : Snake three-finger toxin family, Long-chain subfamily, Type II alpha-neurotoxin sub-subfamily
Tissue Specificity : Expressed by the venom gland.
Paythway :
Uniprot ID : P60615
