Recombinant Dog Lutropin subunit beta (LHB)

Product Description

Recombinant Dog Lutropin subunit beta (LHB) is available at Gentaur for Next week Delivery.

Gene Name: LHB

Alternative Names : Luteinizing hormone subunit beta Short name:LH-B Short name:LSH-B Short name:LSH-beta

Expression Region : 18-138aa

AA Sequence : SRGPLRPLCRPINATLAAENEACPVCITFTTTICAGYCPSMVRVLPAALPPVPQPVCTYHELHFASIRLPGCPPGVDPMVSFPVALSCRCGPCRLSNSDCGGPRAQSLACDRPLLPGLLFL

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 16.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.

Function : Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids.

Involvement in disease :

Subcellular location : Secreted

Protein Families : Glycoprotein hormones subunit beta family

Tissue Specificity :

Paythway :

Uniprot ID : P18842