Recombinant Drosophila melanogaster cAMP-dependent protein kinase catalytic subunit (Pka-C1)

Product Description

Recombinant Drosophila melanogaster cAMP-dependent protein kinase catalytic subunit (Pka-C1) is available at Gentaur for Next week Delivery.

Gene Name: Pka-C1

Alternative Names : Short name: PKA C

Expression Region : 2-353aa

AA Sequence : GNNATTSNKKVDAAETVKEFLEQAKEEFEDKWRRNPTNTAALDDFERIKTLGTGSFGRVMIVQHKPTKDYYAMKILDKQKVVKLKQVEHTLNEKRILQAIQFPFLVSLRYHFKDNSNLYMVLEYVPGGEMFSHLRKVGRFSEPHSRFYAAQIVLAFEYLHYLDLIYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLVYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFGSDLKDLLRNLLQVDLTKRYGNLKAGVNDIKNQKWFASTDWIAIFQKKIEAPFIPRCKGPGDTSNFDDYEEEALRISSTEKCAKEFAEF

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 56.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : ATP + a protein = ADP + a phosphoprotein.

Function :

Involvement in disease :

Subcellular location :

Protein Families : Protein kinase superfamily, AGC Ser/Thr protein kinase family, cAMP subfamily

Tissue Specificity : More abundant in adult head than adult body.

Paythway :

Uniprot ID : P12370