Recombinant Drosophila melanogaster Partner of bursicon (pburs)

Product Description

Recombinant Drosophila melanogaster Partner of bursicon (pburs) is available at Gentaur for Next week Delivery.

Gene Name: pburs

Alternative Names : Bursicon subunit beta

Expression Region : 21-141aa

AA Sequence : LRYSQGTGDENCETLKSEIHLIKEEFDELGRMQRTCNADVIVNKCEGLCNSQVQPSVITPTGFLKECYCCRESFLKEKVITLTHCYDPDGTRLTSPEMGSMDIRLREPTECKCFKCGDFTR

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 15.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.

Function : Final heterodimeric neurohormone released at the end of the molting cycle, involved in the sclerotization (tanning) of the insect cuticle, melanization and wing spreading. Heterodimer specifically activates the G protein-coupled receptor rk.

Involvement in disease :

Subcellular location : Secreted

Protein Families :

Tissue Specificity : Coexpressed with CCAP in most CCAP-specific neurons. Coexpressed with Burs in 4 bilateral neurons in thoracic and abdominal neuromeres of the ventral nervous system.

Paythway :

Uniprot ID : Q9VJS7