Recombinant Enterobacteria phage T6 Beta-glucosyl-HMC-alpha-glucosyl-transferase

Product Description

Recombinant Enterobacteria phage T6 Beta-glucosyl-HMC-alpha-glucosyl-transferase is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names :

Expression Region : 1-280aa

AA Sequence : MIQFVIPSYQRVGAVSALDMFPTDYEPHIVVREHEEKAYNDAYGSRAKIITIPDGVNGIAGTRKAITDMYAGQRIWMIDDDTTIRMSSMRKRDDRRCVDKVNQLTHEQFYELIQYVEDAMDCGYYHGHARLPIFKITSSWGNYRENSYGFTNTWYDLGKLTTEQIGYGKIDLCEDMYAFLNLINQGYPHLALFKYLVVSGKAQAPGGCSSIRSNSKHNRALEQINREFPEQARWKTSNIEKRKSLGEEDEPLKVLRMCVSRKEKSEAFHKFNAIHPIAVD

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 36.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Transfers a gentiobiosyl-group on a hydroxymethylcytosine residue in DNA. Is involved in a DNA modification process to protects the phage genome against its own nucleases and the host restriction endonuclease system.

Function : Transfers a gentiobiosyl-group on a hydroxymethylcytosine residue in DNA. Is involved in a DNA modification process to protects the phage genome against its own nucleases and the host restriction endonuclease system.

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q06718