Product Description
Recombinant Epstein-Barr virus Epstein-Barr nuclear antigen 2 (EBNA2), partial is available at Gentaur for Next week Delivery.
Gene Name: EBNA2
Alternative Names :
Expression Region : 247-454aa
AA Sequence : SYSIPSMTLSPEPLPPPAAPAHPLPGVIYDQQALPPTPGPPWWPPVRDPTPTTQTPPTNTKQGPDQGQGRGRWRGRGRSKGRGRMHKLPEPRRPGPDTSSPSMPQLSPVVSLHQGQGPENSPTPGPSTAGPVCRVTPSATPDISPIHEPESSDSEEPPFLFPSDWYPPTLEPAELDESWEGIFETTESHSSDEENVGGPSKRPRTSTQ
Sequence Info : Partial
Tag Info : N-terminal 6xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 25.9 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Plays a key role in the activation of the host resting B-cell and stimulation of B-cell proliferation. Acts by up-regulating the expression of viral EBNA1-6, LMP1, LMP2A and LMP2B genes, as well as several host genes including CD21, CD23 and MYC. Activates transcription by acting as an adapter molecule that binds to cellular sequence-specific DNA-binding proteins such as host CBF1, SMARCB1 and SPI1. Once EBNA2 is near promoter sites, its acidic activating domain recruits basal and activation-associated transcription factors TFIIB, TAF40, TFIIH components ERCC2 and ERCC3, and CBP in order to promote transcription. Alternatively, EBNA2 can affect activities of cell cycle regulators and retard cell cycle progression at G2/M phase. It also induces chromosomal instability, by disrupting mitotic checkpoints, multi-nucleation and formation of micronuclei in infected cells (By similarity).
Function : Plays a key role in the activation of the host resting B-cell and stimulation of B-cell proliferation. Acts by up-regulating the expression of viral EBNA1-6, LMP1, LMP2A and LMP2B genes, as well as several host genes including CD21, CD23 and MYC. Activates transcription by acting as an adapter molecule that binds to cellular sequence-specific DNA-binding proteins such as host CBF1, SMARCB1 and SPI1. Once EBNA2 is near promoter sites, its acidic activating domain recruits basal and activation-associated transcription factors TFIIB, TAF40, TFIIH components ERCC2 and ERCC3, and CBP in order to promote transcription. Alternatively, EBNA2 can affect activities of cell cycle regulators and retard cell cycle progression at G2/M phase. It also induces chromosomal instability, by disrupting mitotic checkpoints, multi-nucleation and formation of micronuclei in infected cells (By similarity).
Involvement in disease :
Subcellular location : Host nucleus matrix
Protein Families : Herpesviridae EBNA2 family
Tissue Specificity :
Paythway :
Uniprot ID : Q69022
Euro
British Pound
US Dollar