Recombinant Escherichia coli 30S ribosomal protein S13 (rpsM)

Product Description

Recombinant Escherichia coli 30S ribosomal protein S13 (rpsM) is available at Gentaur for Next week Delivery.

Gene Name: rpsM

Alternative Names :

Expression Region : 2-118aa

AA Sequence : ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEGQIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQRTKTNARTRKGPRKPIKK

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal GST-tagged

Theoretical MW : 40 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.

Function : Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA.

Involvement in disease :

Subcellular location :

Protein Families : Universal ribosomal protein uS13 family

Tissue Specificity :

Paythway :

Uniprot ID : P0A7S9