Product Description
Recombinant Escherichia coli Heat-labile enterotoxin B chain (eltB) is available at Gentaur for Next week Delivery.
Gene Name: eltB
Alternative Names : LT-B, human;LTH-B
Expression Region : 22-124aa
AA Sequence : APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEN
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged and C-terminal 6xHis-tagged
Theoretical MW : 17 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
Function : The biological activity of the toxin is produced by the A chain, which activates intracellular adenyl cyclase.
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P0CK94
Euro
British Pound
US Dollar