Recombinant Escherichia coli Methyl-accepting chemotaxis protein I (tsr), partial

Product Description

Recombinant Escherichia coli Methyl-accepting chemotaxis protein I (tsr), partial is available at Gentaur for Next week Delivery.

Gene Name: tsr

Alternative Names : Serine chemoreceptor protein

Expression Region : 211-551aa

AA Sequence : WFGIKASLVAPMNRLIDSIRHIAGGDLVKPIEVDGSNEMGQLAESLRHMQGELMRTVGDVRNGANAIYSGASEIATGNNDLSSRTEQQAASLEETAASMEQLTATVKQNAENARQASHLALSASETAQRGGKVVDNVVQTMRDISTSSQKIADIISVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRNLAQRSAQAAREIKSLIEDSVGKVDVGSTLVESAGETMAEIVSAVTRVTDIMGEIASASDEQSRGIDQVGLAVAEMDRVTQQNAALVEESAAAAAALEEQASRLTEAVAVFRIQQQQRETSAVVKTVTPAAPRKMAVADSEENWETF

Sequence Info : Cytoplasmic Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 38 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Receptor for the attractant L-serine and related amino acids. Is also responsible for chotaxis away from a wide range of repellents, including leucine, indole, and weak acids.Chotactic-signal transducers respond to changes in the concentration of attractants and repellents in the environment, transduce a signal from the outside to the inside of the cell, and facilitate sensory adaptation through the variation of the level of methylation. Attractants increase the level of methylation while repellents decrease the level of methylation, the methyl groups are added by the methyltransferase CheR and roved by the methylesterase CheB.

Function : Receptor for the attractant L-serine and related amino acids. Is also responsible for chemotaxis away from a wide range of repellents, including leucine, indole, and weak acids.; FUNCTION

Involvement in disease :

Subcellular location : Cell inner membrane, Multi-pass membrane protein

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P02942