Product Description
Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel (mscL) is available at Gentaur for Next week Delivery.
Gene Name: mscL
Alternative Names :
Expression Region : 1-136aa
AA Sequence : MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-B2M-tagged
Theoretical MW : 29 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell (By similarity).
Function : Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell.
Involvement in disease :
Subcellular location : Cell inner membrane, Multi-pass membrane protein
Protein Families : MscL family
Tissue Specificity :
Paythway :
Uniprot ID : P0A743
Euro
British Pound
US Dollar