Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel (mscL)

Product Description

Recombinant Escherichia coli O157:H7 Large-conductance mechanosensitive channel (mscL) is available at Gentaur for Next week Delivery.

Gene Name: mscL

Alternative Names :

Expression Region : 1-136aa

AA Sequence : MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-B2M-tagged

Theoretical MW : 29 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell (By similarity).

Function : Channel that opens in response to stretch forces in the membrane lipid bilayer. May participate in the regulation of osmotic pressure changes within the cell.

Involvement in disease :

Subcellular location : Cell inner membrane, Multi-pass membrane protein

Protein Families : MscL family

Tissue Specificity :

Paythway :

Uniprot ID : P0A743