Recombinant Escherichia coli O157:H7 Long-chain fatty acid transport protein (fadL)

Product Description

Recombinant Escherichia coli O157:H7 Long-chain fatty acid transport protein (fadL) is available at Gentaur for Next week Delivery.

Gene Name: fadL

Alternative Names : Outer membrane FadL protein Outer membrane flp protein

Expression Region : 26-446aa

AA Sequence : AGFQLNEFSSSGLGRAYSGEGAIADDAGNVSRNPALITMFDRPTFSAGAVYIDPDVNISGTSPSGRSLKADNIAPTAWVPNMHFVAPINDQFGWGASITSNYGLATEFNDTYAGGSVGGTTDLETMNLNLSGAYRLNNAWSFGLGFNAVYARAKIERFAGDLGQLVAGQIMQSPAGKTPQGQALAATANGIDSNTKIAHLNGNQWGFGWNAGILYELDKNNRYALTYRSEVKIDFKGNYSSDLNRVFNNYGLPIPTATGGATQSGYLTLNLPEMWEVSGYNRVDPQWAIHYSLAYTSWSQFQQLKATSTSGDTLFQKHEGFKDAYRIALGTTYYYDDNWTFRTGIAFDDSPVPAQNRSISIPDQDRFWLSAGTTYAFNKDASVDVGVSYMHGQSVKINEGPYQFESEGKAWLFGTNFNYAF

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 61.9 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Involved in translocation of long-chain fatty acids across the outer membrane. FadL may form a specific channel

Function : Involved in translocation of long-chain fatty acids across the outer membrane. FadL may form a specific channel (By similarity).

Involvement in disease :

Subcellular location : Cell outer membrane, Multi-pass membrane protein

Protein Families : OmpP1/FadL family

Tissue Specificity :

Paythway :

Uniprot ID : Q8XCN6