Recombinant Escherichia coli Outer membrane protein C (ompC)

Product Description

Recombinant Escherichia coli Outer membrane protein C (ompC) is available at Gentaur for Next week Delivery.

Gene Name: ompC

Alternative Names : Outer membrane protein 1BPorin OmpC

Expression Region : 22-367aa

AA Sequence : AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

Sequence Info : Full Length of Mature Protein

Tag Info : Tag-Free

Theoretical MW : 38.3 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Forms pores that allow passive diffusion of small molecules across the outer mbrane.

Function : Forms pores that allow passive diffusion of small molecules across the outer membrane.

Involvement in disease :

Subcellular location : Cell outer membrane, Multi-pass membrane protein

Protein Families : Gram-negative porin family

Tissue Specificity :

Paythway :

Uniprot ID : P06996