Recombinant Escherichia coli Peptidyl-prolyl cis-trans isomerase A (ppiA)

Product Description

Recombinant Escherichia coli Peptidyl-prolyl cis-trans isomerase A (ppiA) is available at Gentaur for Next week Delivery.

Gene Name: ppiA

Alternative Names : PPIase A Alternative name(s): Cyclophilin A Rotamase A

Expression Region : 25-190aa

AA Sequence : AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 34.1 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Immunology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Function : PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides (By similarity).

Involvement in disease :

Subcellular location : Periplasm

Protein Families : Cyclophilin-type PPIase family

Tissue Specificity :

Paythway :

Uniprot ID : P0AFL5