Euro
British Pound
US Dollar
Product Description
Recombinant Gadus morhua Parvalbumin beta is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names : Allergen: Gad m 1
Expression Region : 2-109aa
AA Sequence : AFAGILNDADITAALAACKAEGSFDHKAFFTKVGLAAKSPADIKKVFEIIDQDKSDFVEEDELKLFLQNFSAGARALSDAETKVFLKAGDSDGDGKIGVDEFGAMIKA
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 27.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Allergen
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions
Function : In muscle, parvalbumin is thought to be involved in relaxation after contraction. It binds two calcium ions (By similarity).
Involvement in disease :
Subcellular location :
Protein Families : Parvalbumin family
Tissue Specificity :
Paythway :
Uniprot ID : Q90YK9
