Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1

Product Description

Recombinant Gloydius ussuriensis Thrombin-like enzyme calobin-1 is available at Gentaur for Next week Delivery.

Gene Name: N/A

Alternative Names : Calobin I (Fibrinogen-clotting enzyme) (Snake venom serine protease) (SVSP) (SVTLE)

Expression Region : 25-262aa

AA Sequence : VIGGDECNINEHRFLVALYNSRSRTLFCGGTLINQEWVLTAAHCERKNFRIKLGIHSKKVPNEDEQTRVPKEKFFCLSSKNYTLWDKDIMLIRLDSPVSNSEHIAPLSLPSSPPSVGSVCRIMGWGRISPTKETYPDVPHCANINLLEYEMCRAPYPEFGLPATSRTLCAGILEGGKDTCRGDSGGPLICNGQFQGIASWGDDPCAQPHKPAAYTKVFDHLDWIQSIIAGNTDASCPP

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 33.7 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Thrombin-like snake venom serine protease. Has a coagulant activity. Acts on alpha-chains of fibrinogen generating fibrinopeptide A.

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : Q91053