Product Description
Recombinant Glycine max Cell division cycle protein 48 homolog (CDC48), partial is available at Gentaur for Next week Delivery.
Gene Name: CDC48
Alternative Names : Valosin-containing protein homolog Short name: VCP
Expression Region : 653-807aa
AA Sequence : DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS
Sequence Info : Partial
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 33.5 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Neuroscience
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Probably functions in cell division and growth processes.
Function : Probably functions in cell division and growth processes.
Involvement in disease :
Subcellular location : Cell membrane, Peripheral membrane protein
Protein Families : AAA ATPase family
Tissue Specificity :
Paythway :
Uniprot ID : P54774
Euro
British Pound
US Dollar