Recombinant Glycine max Cell division cycle protein 48 homolog (CDC48), partial

Product Description

Recombinant Glycine max Cell division cycle protein 48 homolog (CDC48), partial is available at Gentaur for Next week Delivery.

Gene Name: CDC48

Alternative Names : Valosin-containing protein homolog Short name: VCP

Expression Region : 653-807aa

AA Sequence : DEDSRHQIFKACLRKSPIAKNVDLRALARHTQGFSGADITEICQRACKYAIRENIEKDIERERKSRENPEAMDEDTVDDEVAEIKAAHFEESMKFARRSVSDADIRKYQAFAQTLQQSRGFGSEFRFPESGDRTTTGSDPFAASAGGADEDDLYS

Sequence Info : Partial

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 33.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Neuroscience

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Probably functions in cell division and growth processes.

Function : Probably functions in cell division and growth processes.

Involvement in disease :

Subcellular location : Cell membrane, Peripheral membrane protein

Protein Families : AAA ATPase family

Tissue Specificity :

Paythway :

Uniprot ID : P54774