Recombinant Guinea pig Membrane cofactor protein (CD46), partial

Product Description

Recombinant Guinea pig Membrane cofactor protein (CD46), partial is available at Gentaur for Next week Delivery.

Gene Name: CD46

Alternative Names : CD_antigen: CD46

Expression Region : 36-316aa

AA Sequence : CVLPPPFEAMEPINPKPYYEIGEKVEYRCKKGYLRQPFYLMVATCEKNHSWVPITDDGCIKKQCTYLNPPPKGRVEYINGTRTWGDIVHFSCVEGFYVSGIAALSCELRGDNVDWNGRVPTCEKVLCSPPPKIQNGKYTFSDVQVFEYFEAVTYSCDAVQGPDKLSLVGNEVLYCAGHQKWSSAAPECKVVKCPLPVVKNGKQISGLGQTFFYQATVTFQCLPGFYFNGSSTVVCGSDNTWKPSIPECLKGPKPTHPTKPPVYNYPGYPNPREGIFDQELN

Sequence Info : Extracellular Domain

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 35.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May be involved in the fusion of the spermatozoa with the oocyte during fertilization.

Function : May be involved in the fusion of the spermatozoa with the oocyte during fertilization.

Involvement in disease :

Subcellular location : Membrane, Single-pass type I membrane protein

Protein Families :

Tissue Specificity : Preferentially expressed in testis.

Paythway :

Uniprot ID : P70105