Product Description
Recombinant Helicobacter pylori Putative peptidyl-prolyl cis-trans isomerase HP_0175 (HP-0175) (Active) is available at Gentaur for Next week Delivery.
Gene Name: HP-0175
Alternative Names : Rotamase HP_0175
Expression Region : 22-299aa
AA Sequence : KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 58.8 kDa
Storage Buffer : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 ?g/ml can bind human HP_0175 with a linear range of 31.25-600.00 ng/ml.
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P56112
Euro
British Pound
US Dollar