Recombinant Helicobacter pylori Putative peptidyl-prolyl cis-trans isomerase HP_0175 (HP-0175) (Active)

Product Description

Recombinant Helicobacter pylori Putative peptidyl-prolyl cis-trans isomerase HP_0175 (HP-0175) (Active) is available at Gentaur for Next week Delivery.

Gene Name: HP-0175

Alternative Names : Rotamase HP_0175

Expression Region : 22-299aa

AA Sequence : KPAHNANNATHNTKKTTDSSAGVLATVDGRPITKSDFDMIKQRNPNFDFDKLKEKEKEALIDQAIRTALVENEAKTEKLDSTPEFKAMMEAVKKQALVEFWAKKQAEEVKKVQIPEKEMQDFYNANKDQLFVKQEAHARHILVKTEDEAKRIISEIDKQPKAKKEAKFIELANRDTIDPNSKNAQNGGDLGKFQKNQMAPDFSKAAFALTPGDYTKTPVKTEFGYHIIYLISKDSPVTYTYEQAKPTIKGMLQEKLFQERMNQRIEELRKHAKIVINK

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 58.8 kDa

Storage Buffer : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Measured by its binding ability in a functional ELISA. Immobilized yuaB at 5 ?g/ml can bind human HP_0175 with a linear range of 31.25-600.00 ng/ml.

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Others

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location :

Protein Families :

Tissue Specificity :

Paythway :

Uniprot ID : P56112