Product Description
Recombinant Hirudo medicinalis Hirudin variant-1 is available at Gentaur for Next week Delivery.
Gene Name: N/A
Alternative Names :
Expression Region : 1-65aa
AA Sequence : LVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 34 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen.
Function : Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen.
Involvement in disease :
Subcellular location : Secreted
Protein Families : Protease inhibitor I14 (hirudin) family
Tissue Specificity :
Paythway :
Uniprot ID : P01050
 Euro
            
 British Pound
            
 US Dollar