Product Description
Recombinant Horse Serum amyloid A protein (SAA1) is available at Gentaur for Next week Delivery.
Gene Name: SAA1
Alternative Names : Amyloid fibril protein AA
Expression Region : 1-110aa
AA Sequence : LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY
Sequence Info : Full Length
Tag Info : N-terminal 10xHis-tagged
Theoretical MW : 15.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Major acute phase reactant. Apolipoprotein of the HDL complex.
Function : Major acute phase reactant. Apolipoprotein of the HDL complex.
Involvement in disease : Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.
Subcellular location :
Protein Families : SAA family
Tissue Specificity : Expressed by the liver; secreted in plasma.
Paythway :
Uniprot ID : P19857
Euro
British Pound
US Dollar