Toggle menu
020 3393 8531
  • EUR
    • British Pound
    • Euro
    • US Dollar
    • LoginorSign Up
    • 0
    Orla Protein Technologies
    ×
    • EUR
      • British Pound
      • Euro
      • US Dollar
    ×

      Main Menu

    • Distributors
    • Shipping & Returns
    • Contact Us
    • Blog
      • OralSurf
      • boston biochem
      • Application of high-pressURE
      • Bone-resorption
      • Btf5
      • buffy coats
      • Cathepsin-d
      • cryopreservation of cells
      • Dissociation constant kd
      • Facs protocol
      • Foxp3 antibody
      • foxp3-staining-kit
      • gamma-delta-t-cells
      • Gp120-antibody
      • Growing artificial organs
      • Human-like collagen promotes the healing of acetic acid-induced gastric ulcers in rats by regulating NOS and growth factors
      • paraffin sections
      • Pas stain for fungus
      • Periodic acid schiff
      • Potential of plants to produce recombinant protein products
      • Rabbit Polyclonals
      • Staining antibodies protocol
      • U.S. Food and Drug Administration anticancer drug approval trends from 2016 to 2018 for lung, colorectal, breast, and prostate cancer
      • Vial
    • Shop By Category

    • 2019-nCoV Antibody
    • 2019-nCoV Protein
    • AccuCount
    • Allergen
    • Antibody
    • Antigen
    • Assay Developers
    • Assay Kit
    • Blocking Peptides
    • Cells
    • Clinical Laboratories
    • COVID-19
    • DNA
    • Elisa Kit
    • Elisa Kits
    • Extraction
    • Flow Cytometry
    • Humanazied Antibody
    • Humanized monoclonal antibody
    • IBT Bioservices
    • Immuno-Histo Chemistry
    • Medium & Cell Culture
    • Oxidation
    • PCR Kit
    • Rabbit polyclonal
    • SD Bioline
    • Serum
    • Stem Cell Marker
    • Vector
    • Virus
    • Antibodies
    • Assay
    • Cell
    • Coronavirus
    • ExoQuick
    • Fluorescence
    • Gel
    • Lab
    • Magnetic Beads
    • Molecular Biology
    • NatTrol
    • OneqPCR RealTime
    • Oxiselect
    • PAB Polyconals
    • Panbio
    • Plasmid
    • qPCR
    • QuantiChrom
    • Rainbow
    • Reagent
    • Recombinant
    • Solution
    • SPHERO
    • Spoligotyping
    • Stain
    • Monoclonal
    • Protein
    • RNA Isolation
    • Dounce homogenizer
    • Antigen ELISA
    • Assay Tests
    • Branched DNA Assay
    • Recombinant Proteins
    • Select Currency: EUR
      • British Pound
      • Euro
      • US Dollar
    • Gift Certificates
    • Login or Sign Up
    ×

      Main Menu

    • Distributors
    • Shipping & Returns
    • Contact Us
    • Blog
      • OralSurf
      • boston biochem
      • Application of high-pressURE
      • Bone-resorption
      • Btf5
      • buffy coats
      • Cathepsin-d
      • cryopreservation of cells
      • Dissociation constant kd
      • Facs protocol
      • Foxp3 antibody
      • foxp3-staining-kit
      • gamma-delta-t-cells
      • Gp120-antibody
      • Growing artificial organs
      • Human-like collagen promotes the healing of acetic acid-induced gastric ulcers in rats by regulating NOS and growth factors
      • paraffin sections
      • Pas stain for fungus
      • Periodic acid schiff
      • Potential of plants to produce recombinant protein products
      • Rabbit Polyclonals
      • Staining antibodies protocol
      • U.S. Food and Drug Administration anticancer drug approval trends from 2016 to 2018 for lung, colorectal, breast, and prostate cancer
      • Vial
    • Shop By Category

    • 2019-nCoV Antibody
    • 2019-nCoV Protein
    • AccuCount
    • Allergen
    • Antibody
    • Antigen
    • Assay Developers
    • Assay Kit
    • Blocking Peptides
    • Cells
    • Clinical Laboratories
    • COVID-19
    • DNA
    • Elisa Kit
    • Elisa Kits
    • Extraction
    • Flow Cytometry
    • Humanazied Antibody
    • Humanized monoclonal antibody
    • IBT Bioservices
    • Immuno-Histo Chemistry
    • Medium & Cell Culture
    • Oxidation
    • PCR Kit
    • Rabbit polyclonal
    • SD Bioline
    • Serum
    • Stem Cell Marker
    • Vector
    • Virus
    • Antibodies
    • Assay
    • Cell
    • Coronavirus
    • ExoQuick
    • Fluorescence
    • Gel
    • Lab
    • Magnetic Beads
    • Molecular Biology
    • NatTrol
    • OneqPCR RealTime
    • Oxiselect
    • PAB Polyconals
    • Panbio
    • Plasmid
    • qPCR
    • QuantiChrom
    • Rainbow
    • Reagent
    • Recombinant
    • Solution
    • SPHERO
    • Spoligotyping
    • Stain
    • Monoclonal
    • Protein
    • RNA Isolation
    • Dounce homogenizer
    • Antigen ELISA
    • Assay Tests
    • Branched DNA Assay
    • Recombinant Proteins
    • Select Currency: EUR
      • British Pound
      • Euro
      • US Dollar
    • Gift Certificates
    • Login or Sign Up

    Shop by Category

  • 2019-nCoV Antibody
  • 2019-nCoV Protein
  • AccuCount
  • Allergen
  • Antibody
  • Antigen
  • Assay Developers
  • Assay Kit
  • Blocking Peptides
  • Cells
  • Clinical Laboratories
  • COVID-19
  • DNA
  • Elisa Kit
  • Elisa Kits
  • Extraction
  • Flow Cytometry
  • Humanazied Antibody
  • Humanized monoclonal antibody
  • IBT Bioservices
  • Immuno-Histo Chemistry
  • Medium & Cell Culture
  • Oxidation
  • PCR Kit
  • Rabbit polyclonal
  • SD Bioline
  • Serum
  • Stem Cell Marker
  • Vector
  • Virus
  • Antibodies
  • Assay
  • Cell
  • Coronavirus
  • ExoQuick
  • Fluorescence
  • Gel
  • Lab
  • Magnetic Beads
  • Molecular Biology
  • NatTrol
  • OneqPCR RealTime
  • Oxiselect
  • PAB Polyconals
  • Panbio
  • Plasmid
  • qPCR
  • QuantiChrom
  • Rainbow
  • Reagent
  • Recombinant
  • Solution
  • SPHERO
  • Spoligotyping
  • Stain
  • Monoclonal
  • Protein
  • RNA Isolation
  • Dounce homogenizer
  • Antigen ELISA
  • Assay Tests
  • Branched DNA Assay
  • Recombinant Proteins
  • Shop by Brand

  • Nova Tech
  • Biomatik Proteins
  • Fine Test
  • MBS
  • Life Science M
  • Mybiosource
  • Fine Test Ltd
  • Wuhan Fine Biotech
  • Nova Life
  • Bioscience
  • View all Brands
    • Home
    • Recombinant Proteins
    • Recombinant Horse Serum amyloid A (SAA1)
  • Recombinant Horse Serum amyloid A (SAA1)
  • Recombinant Horse Serum amyloid A (SAA1)

    Recombinant Horse Serum amyloid A (SAA1)

    Biomatik Proteins

    MSRP:
    Now: €686.00
    (You save )
    (No reviews yet) Write a Review
    SKU:
    RPC24934
    Availability:
    Next Week
    Shipping:
    Calculated at Checkout
    Source:
    Yeast
    Species:
    Equus caballus (Horse)
    Purity:
    >90% as determined by SDS-PAGE.
    Uniprot:
    P19857
    Shipping Condition:
    Ice packs
    Expiry Date:
    1 year

    Adding to cart… category.add_cart_announcement
    Add to Wish List
    • Create New Wish List
    • Facebook
    • Email
    • Print
    • Twitter
    • Pinterest
    • Overview
    • Reviews

    Product Description

    Recombinant Horse Serum amyloid A (SAA1) is available at Gentaur for Next week Delivery.

    Gene Name: SAA1

    Alternative Names : Amyloid fibril protein AA

    Expression Region : 1-110aa

    AA Sequence : LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY

    Sequence Info : Full Length

    Tag Info : N-terminal 6xHis-tagged

    Theoretical MW : 14.3 kDa

    Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

    Endotoxin Level : Not tested-

    Biological Activity : Not tested

    Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

    Research Area : Others

    Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

    Relevance : Major acute phase reactant. Apolipoprotein of the HDL complex.

    Function : Major acute phase reactant. Apolipoprotein of the HDL complex.

    Involvement in disease : Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.

    Subcellular location :

    Protein Families : SAA family

    Tissue Specificity : Expressed by the liver; secreted in plasma.

    Paythway :

    Uniprot ID : P19857

     

     

    Product Videos

    Custom Field

    Source Yeast
    Species Equus caballus (Horse)
    Purity >90% as determined by SDS-PAGE.
    Uniprot P19857
    Shipping Condition Ice packs
    Expiry Date 1 year

    Product Reviews

    Write a Review

    Write a Review

    ×
    Recombinant Horse Serum amyloid A (SAA1)
    Biomatik Proteins
    Recombinant Horse Serum amyloid A (SAA1)

    You May Also Like...

    • FastAmp® Viral and Cell Solution for Covid-19 Testing FastAmp® Viral and Cell Solution for Covid-19 Testing
      Quick view Details

      Intact Genomics

      |

      sku: 4631

      FastAmp® Viral and Cell Solution for Covid-19 Testing

      MSRP:
      Now: €5,150.00
      Choose Options
    • FastAmp® Plant Direct PCR & Genotyping Solution FastAmp® Plant Direct PCR & Genotyping Solution
      Quick view Details

      Intact Genomics

      |

      sku: 4611

      FastAmp® Plant Direct PCR & Genotyping Solution

      MSRP:
      Now: €235.00
      Choose Options
    • RNase Inhibitor, Murine RNase Inhibitor, Murine
      Quick view Details

      Intact Genomics

      |

      sku: 3714

      RNase Inhibitor, Murine

      MSRP:
      Now: €345.00
      Choose Options
    • igScript™ Probe-Based RT-qPCR Kit igScript™ Probe-Based RT-qPCR Kit
      Quick view Details

      Intact Genomics

      |

      sku: 4243

      igScript™ Probe-Based RT-qPCR Kit

      MSRP:
      Now: €369.00
      Choose Options
    • One Step RT-qPCR kit for SARSCoV-2 (COVID-19) detections One Step RT-qPCR kit for SARSCoV-2 (COVID-19) detections
      Quick view Details

      Intact Genomics

      |

      sku: 4223

      One Step RT-qPCR kit for SARSCoV-2 (COVID-19) detections

      MSRP:
      Now: €2,245.00
      Choose Options
    • FastAmp™ Plant Direct PCR Kit FastAmp™ Plant Direct PCR Kit
      Quick view Details

      Intact Genomics

      |

      sku: 4612

      FastAmp™ Plant Direct PCR Kit

      MSRP:
      Now: €545.00
      Choose Options
    • T4 DNA Ligase T4 DNA Ligase
      Quick view Details

      Intact Genomics

      |

      sku: 3212

      T4 DNA Ligase

      MSRP:
      Now: €245.00
      Choose Options
    • Recovery Medium Recovery Medium
      Quick view Details

      Intact Genomics

      |

      sku: 1711

      Recovery Medium

      MSRP:
      Now: €130.00
      Choose Options
    • DL39 (DE3) Chemically Competent Cells DL39 (DE3) Chemically Competent Cells
      Quick view Details

      Intact Genomics

      |

      sku: 1061-24

      DL39 (DE3) Chemically Competent Cells

      MSRP:
      Now: €515.00
      Choose Options
    • igMax™ DH10B ElectroCompetent Cells igMax™ DH10B ElectroCompetent Cells
      Quick view Details

      Intact Genomics

      |

      sku: 1212-12

      igMax™ DH10B ElectroCompetent Cells

      MSRP:
      Now: €245.00
      Choose Options
    • DH5-Alpha Chemically Competent Cells DH5-Alpha Chemically Competent Cells
      Quick view Details

      Intact Genomics

      |

      sku: 1031-12

      DH5-Alpha Chemically Competent Cells

      MSRP:
      Now: €155.00
      Choose Options
    • Anti Acrolein (ACR) monoclonal antibody (5F6) Anti Acrolein (ACR) monoclonal antibody (5F6)
      Quick view Details

      Jaica

      |

      sku: MHN-100P

      Anti Acrolein (ACR) monoclonal antibody (5F6)

      MSRP:
      Now: €840.00
      Add to Cart

    Recommended

    • Recombinant Cat Serum amyloid A protein (SAA1), partial Recombinant Cat Serum amyloid A protein (SAA1), partial
      Quick view Details

      Biomatik Proteins

      |

      sku: RPC24933

      Recombinant Cat Serum amyloid A protein (SAA1), partial

      MSRP:
      Now: €487.00
      Choose Options
    • Recombinant Dog Serum amyloid A protein (SAA1) Recombinant Dog Serum amyloid A protein (SAA1)
      Quick view Details

      Biomatik Proteins

      |

      sku: RPC20081

      Recombinant Dog Serum amyloid A protein (SAA1)

      MSRP:
      Now: €487.00
      Choose Options
    • Recombinant Horse Serum amyloid A protein (SAA1) Recombinant Horse Serum amyloid A protein (SAA1)
      Quick view Details

      Biomatik Proteins

      |

      sku: RPC25693

      Recombinant Horse Serum amyloid A protein (SAA1)

      MSRP:
      Now: €614.00
      Choose Options
    • Recombinant Mouse Serum amyloid A-1 protein (Saa1) Recombinant Mouse Serum amyloid A-1 protein (Saa1)
      Quick view Details

      Biomatik Proteins

      |

      sku: RPC20304

      Recombinant Mouse Serum amyloid A-1 protein (Saa1)

      MSRP:
      Now: €398.00
      Choose Options
    • Recombinant Rabbit Serum amyloid A-1 protein (SAA1) Recombinant Rabbit Serum amyloid A-1 protein (SAA1)
      Quick view Details

      Biomatik Proteins

      |

      sku: RPC21968

      Recombinant Rabbit Serum amyloid A-1 protein (SAA1)

      MSRP:
      Now: €498.00
      Choose Options
    ×
    ×
    Join Our Mailing List for special offers!
    Contact Us
    Unicorn House, Station Cl
    Hertfordshire, Potters Bar EN6 1TL
    Whetstone London N20 9BH
    Accounts & Orders
    • Wishlist
    • Login or Sign Up
    • Shipping & Returns
    Quick Links
    • Distributors
    • Shipping & Returns
    • Contact Us
    • Blog
    Recent Blog Posts
    • Single Domain Antibodies: Therapeutic Tools for the Future?
    • Macs Beads
    • SMAD7
    • New insights into Sauropsid Papillomaviridae evolution and epizootiology: discovery of two novel papillomaviruses in native and invasive Island geckos
    Connect with Us:
    • © Orla Protein Technologies
    • |
    • Sitemap