Product Description
Recombinant Human 14-3-3 protein zeta/delta (YWHAZ), partial is available at Gentaur for Next week Delivery.
Gene Name: YWHAZ
Alternative Names : Protein kinase C inhibitor protein 1 (KCIP-1)
Expression Region : 133-212aa
AA Sequence : AAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYK
Sequence Info : Partial
Tag Info : N-terminal 6xHis-GST-tagged
Theoretical MW : 40.6 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.
Function :
Involvement in disease :
Subcellular location :
Protein Families :
Tissue Specificity :
Paythway :
Uniprot ID : P63104
 Euro
            
 British Pound
            
 US Dollar