Euro
British Pound
US Dollar
Product Description
Recombinant Human 14KDA phosphohistidine phosphatase (PHPT1) is available at Gentaur for Next week Delivery.
Gene Name: PHPT1
Alternative Names : Phosphohistidine phosphatase 1;Protein janus-A homolog
Expression Region : 1-125aa
AA Sequence : MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Sequence Info : Full Length
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 15.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cell Biology
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Exhibits phosphohistidine phosphatase activity.
Function : Exhibits phosphohistidine phosphatase activity.
Involvement in disease :
Subcellular location : Cytoplasm
Protein Families : Janus family
Tissue Specificity : Expressed abundantly in heart and skeletal muscle.
Paythway :
Uniprot ID : Q9NRX4
