Recombinant Human 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10)

Product Description

Recombinant Human 3-hydroxyacyl-CoA dehydrogenase type-2 (HSD17B10) is available at Gentaur for Next week Delivery.

Gene Name: HSD17B10

Alternative Names : 17-beta-hydroxysteroid dehydrogenase 10 (EC:1.1.1.51);17-beta-HSD 103-hydroxy-2-methylbutyryl-CoA dehydrogenase (EC:1.1.1.178)3-hydroxyacyl-CoA dehydrogenase type IIEndoplasmic reticulum-associated amyloid beta-peptide-binding protein;Mitochondrial ribonuclease P protein 2;Mitochondrial RNase P protein 2Short chain dehydrogenase/reductase family 5C member 1Short-chain type dehydrogenase/reductase XH98G2Type II HADH

Expression Region : 2-261aa

AA Sequence : AAACRSVKGLVAVITGGASGLGLATAERLVGQGASAVLLDLPNSGGEAQAKKLGNNCVFAPADVTSEKDVQTALALAKGKFGRVDVAVNCAGIAVASKTYNLKKGQTHTLEDFQRVLDVNLMGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIVGMTLPIARDLAPIGIRVMTIAPGLFGTPLLTSLPEKVCNFLASQVPFPSRLGDPAEYAHLVQAIIENPFLNGEVIRLDGAIRMQP

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 42.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transcription

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/TRMT10C, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends. Catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone. Catalyzes the third step in the beta-oxidation of fatty acids. Carries out oxidative conversions of 7-alpha-OH and 7-beta-OH bile acids. Also exhibits 20-beta-OH and 21-OH dehydrogenase activities with C21 steroids. By interacting with intracellular amyloid-beta, it may contribute to the neuronal dysfunction associated with Alzheimer disease (AD).

Function : Mitochondrial dehydrogenase that catalyzes the beta-oxidation at position 17 of androgens and estrogens and has 3-alpha-hydroxysteroid dehydrogenase activity with androsterone

Involvement in disease : HDS10 mitochondrial disease (HSD10MD); Mental retardation, X-linked 17 (MRX17)

Subcellular location : Mitochondrion

Protein Families : Short-chain dehydrogenases/reductases (SDR) family

Tissue Specificity : Ubiquitously expressed in normal tissues but is overexpressed in neurons affected in AD.

Paythway :

Uniprot ID : Q99714