Euro
British Pound
US Dollar
Product Description
Recombinant Human 40S ribosomal protein S27 (RPS27) is available at Gentaur for Next week Delivery.
Gene Name: RPS27
Alternative Names : Metallopan-stimulin 1
Expression Region : 1-84aa
AA Sequence : PLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 36.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Others
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function : Component of the small ribosomal subunit
Involvement in disease : Diamond-Blackfan anemia 17 (DBA17)
Subcellular location :
Protein Families : Eukaryotic ribosomal protein eS27 family
Tissue Specificity : Expressed in a wide variety of actively proliferating cells and tumor tissues.
Paythway :
Uniprot ID : P42677
