Product Description
Recombinant Human 60S ribosomal protein L10a (RPL10A), partial is available at Gentaur for Next week Delivery.
Gene Name: RPL10A
Alternative Names : CSA-19Neural precursor cell expressed developmentally down-regulated protein 6;NEDD-6
Expression Region : 4-215aa
AA Sequence : KVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQR
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 51.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance :
Function : Component of the large ribosomal subunit.
Involvement in disease :
Subcellular location :
Protein Families : Universal ribosomal protein uL1 family
Tissue Specificity :
Paythway :
Uniprot ID : P62906
Euro
British Pound
US Dollar