Recombinant Human 60S ribosomal protein L10a (RPL10A), partial

Product Description

Recombinant Human 60S ribosomal protein L10a (RPL10A), partial is available at Gentaur for Next week Delivery.

Gene Name: RPL10A

Alternative Names : CSA-19Neural precursor cell expressed developmentally down-regulated protein 6;NEDD-6

Expression Region : 4-215aa

AA Sequence : KVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQKDKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLAKKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVLCLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQR

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 51.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : Component of the large ribosomal subunit.

Involvement in disease :

Subcellular location :

Protein Families : Universal ribosomal protein uL1 family

Tissue Specificity :

Paythway :

Uniprot ID : P62906