Recombinant Human 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7)

Product Description

Recombinant Human 60S ribosome subunit biogenesis protein NIP7 homolog (NIP7) is available at Gentaur for Next week Delivery.

Gene Name: NIP7

Alternative Names : KD93

Expression Region : 1-180aa

AA Sequence : MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT

Sequence Info : Full Length

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 36.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Epigenetics and Nuclear Signaling

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Required for proper 34S pre-rRNA processing and 60S ribosome subunit assbly.

Function : Required for proper 34S pre-rRNA processing and 60S ribosome subunit assembly.

Involvement in disease :

Subcellular location : Nucleus, nucleolus

Protein Families : NIP7 family

Tissue Specificity : Expressed in hematopoietic stem/progenitor cells.

Paythway :

Uniprot ID : Q9Y221