Euro
British Pound
US Dollar
Product Description
Recombinant Human A disintegrin and metalloproteinase with thrombospondin motifs 2 (ADAMTS2), partial is available at Gentaur for Next week Delivery.
Gene Name: ADAMTS2
Alternative Names : Procollagen I N-proteinase (PC I-NP) (Procollagen I/II amino propeptide-processing enzyme) (Procollagen N-endopeptidase) (pNPI) (ADAM-TS 2) (ADAM-TS2) (ADAMTS-2) (PCINP) (PCPNI)
Expression Region : 254-492aa
AA Sequence : RRRARRHAADDDYNIEVLLGVDDSVVQFHGKEHVQKYLLTLMNIVNEIYHDESLGAHINVVLVRIILLSYGKSMSLIEIGNPSQSLENVCRWAYLQQKPDTGHDEYHDHAIFLTRQDFGPSGMQGYAPVTGMCHPVRSCTLNHEDGFSSAFVVAHETGHVLGMEHDGQGNRCGDEVRLGSIMAPLVQAAFHRFHWSRCSQQELSRYLHSYDCLLDDPFAHDWPALPQLPGLHYSMNEQC
Sequence Info : Partial
Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged
Theoretical MW : 32.2 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cancer
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. May also play a role in development that is independent of its role in collagen biosynthesis.
Function : Cleaves the propeptides of type I and II collagen prior to fibril assembly. Does not act on type III collagen. May also play a role in development that is independent of its role in collagen biosynthesis.
Involvement in disease : Ehlers-Danlos syndrome 7C (EDS7C)
Subcellular location : Secreted, extracellular space, extracellular matrix
Protein Families :
Tissue Specificity : Expressed at high level in skin, bone, tendon and aorta and at low levels in thymus and brain.
Paythway :
Uniprot ID : O95450
