Recombinant Human Abhydrolase domain-containing protein 14B (ABHD14B)

Product Description

Recombinant Human Abhydrolase domain-containing protein 14B (ABHD14B) is available at Gentaur for Next week Delivery.

Gene Name: ABHD14B

Alternative Names :

Expression Region : 2-210aa

AA Sequence : AASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQ

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-SUMO-tagged

Theoretical MW : 38.2 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cell Biology

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function : Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.

Involvement in disease :

Subcellular location : Cytoplasm, Nucleus

Protein Families : AB hydrolase superfamily, ABHD14 family

Tissue Specificity : Ubiquitous. Detected in spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocyte, heart, placenta, lung, liver, skeletal muscle, pancreas and kidney.

Paythway :

Uniprot ID : Q96IU4