Recombinant Human Actin-like protein 8 (ACTL8)

Product Description

Recombinant Human Actin-like protein 8 (ACTL8) is available at Gentaur for Next week Delivery.

Gene Name: ACTL8

Alternative Names : Cancer/testis antigen 57 (CT57)

Expression Region : 1-366aa

AA Sequence : MAARTVIIDHGSGFLKAGTAGWNEPQMVFPNIVNYLPCKENPGPSYARRRVSLGIDICHPDTFSYPIERGRILNWEGVQYLWSFVLENHRREQEVPPVIITETPLREPADRKKMLEILFELLHVPSVLLADQLQMSLYASGLLTGVVVDSGYGLTRVQPFHQGRPLPASGKTLEFAGQDLSAYLLKSLFKEDCDRRCLFQLETVAVTQMNKCYVPQNLGEALDFRERQQSALDESNTYQLPDGSRVELTPMQRVAPEMFFSPQVFEQPGPSIPRAIVESVESCEISLRPLLVSHVMACGGNTLYPGFTKRLFRELMGDHVSSTKATVWEGSNRNFSVWLGASVVAHLSTYQSEWMSREEYGEHMRM

Sequence Info : Full Length

Tag Info : N-terminal 10xHis-tagged and C-terminal Myc-tagged

Theoretical MW : 45.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance :

Function :

Involvement in disease :

Subcellular location : Cytoplasm, cytoskeleton

Protein Families : Actin family

Tissue Specificity : Strongly expressed in testis and pancreas. Weak expression in placenta.

Paythway :

Uniprot ID : Q9H568