Recombinant Human ADP-ribosylation factor 4 (ARF4)

Product Description

Recombinant Human ADP-ribosylation factor 4 (ARF4) is available at Gentaur for Next week Delivery.

Gene Name: ARF2

Alternative Names :

Expression Region : 1-180aa

AA Sequence : MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGGQDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMTDKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 47.5 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Transport

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Function : GTP-binding protein that functions as an allosteric activator of the cholera toxin catalytic subunit, an ADP-ribosyltransferase. Involved in protein trafficking; may modulate vesicle budding and uncoating within the Golgi apparatus.

Involvement in disease :

Subcellular location : Golgi apparatus, Membrane, Lipid-anchor

Protein Families : Small GTPase superfamily, Arf family

Tissue Specificity :

Paythway :

Uniprot ID : P18085