Product Description
Recombinant Human ADP-ribosylation factor-like protein 2-binding protein (ARL2BP) is available at Gentaur for Next week Delivery.
Gene Name: ARL2BP
Alternative Names : Binder of ARF2 protein 1
Expression Region : 1-163aa
AA Sequence : MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH
Sequence Info : Full Length
Tag Info : N-terminal GST-tagged
Theoretical MW : 45.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. May play a role as an effector of ARL2.
Function : Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. May play a role as an effector of ARL2.
Involvement in disease : Retinitis pigmentosa with or without situs inversus (RPSI)
Subcellular location : Cytoplasm, Mitochondrion intermembrane space, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Nucleus, Cytoplasm, cytoskeleton, spindle, Cytoplasm, cytoskeleton, cilium basal body
Protein Families : ARL2BP family
Tissue Specificity : Expressed in retina pigment epithelial cells (at protein level). Widely expressed.
Paythway :
Uniprot ID : Q9Y2Y0
Euro
British Pound
US Dollar