Recombinant Human ADP-ribosylation factor-like protein 2-binding protein (ARL2BP)

Product Description

Recombinant Human ADP-ribosylation factor-like protein 2-binding protein (ARL2BP) is available at Gentaur for Next week Delivery.

Gene Name: ARL2BP

Alternative Names : Binder of ARF2 protein 1

Expression Region : 1-163aa

AA Sequence : MDALEGESFALSFSSASDAEFDAVVGYLEDIIMDDEFQLLQRNFMDKYYLEFEDTEENKLIYTPIFNEYISLVEKYIEEQLLQRIPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNNLRH

Sequence Info : Full Length

Tag Info : N-terminal GST-tagged

Theoretical MW : 45.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. May play a role as an effector of ARL2.

Function : Together with ARL2, plays a role in the nuclear translocation, retention and transcriptional activity of STAT3. May play a role as an effector of ARL2.

Involvement in disease : Retinitis pigmentosa with or without situs inversus (RPSI)

Subcellular location : Cytoplasm, Mitochondrion intermembrane space, Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, Nucleus, Cytoplasm, cytoskeleton, spindle, Cytoplasm, cytoskeleton, cilium basal body

Protein Families : ARL2BP family

Tissue Specificity : Expressed in retina pigment epithelial cells (at protein level). Widely expressed.

Paythway :

Uniprot ID : Q9Y2Y0