Euro
British Pound
US Dollar
Product Description
Recombinant Human Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 (ALKBH3) is available at Gentaur for Next week Delivery.
Gene Name: ALKBH3
Alternative Names : Alkylated DNA repair protein alkB homolog 3DEPC-1;Prostate cancer antigen 1
Expression Region : 1-170aa
AA Sequence : MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPRVIEEGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIREDSILQLTFKKSAPVSGTATAPQSCWYERPSPPHIPGPAILTRTRLWAP
Sequence Info : Full Length of Isoform 2
Tag Info : N-terminal 6xHis-SUMO-tagged
Theoretical MW : 35.3 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Epigenetics and Nuclear Signaling
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Dioxygenase that repairs alkylated DNA containing 1-methyladenine (1meA) and 3-methylcytosine (3meC) by oxidative dethylation. Has a strong preference for single-stranded DNA. Able to process alkylated 3mC within double-stranded regions via its interaction with ASCC3, which promotes DNA unwinding to generate single-stranded substrate needed for ALKHB3. May also act on RNA. Requires molecular oxygen, alpha-ketoglutarate and iron.
Function : Dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A)
Involvement in disease :
Subcellular location : Nucleus, Cytoplasm
Protein Families : AlkB family
Tissue Specificity : Ubiquitous. Detected in heart, pancreas, skeletal muscle, thymus, testis, ovary, spleen, prostate, small intestine, peripheral blood leukocytes, urinary bladder and colon.
Paythway :
Uniprot ID : Q96Q83
