Product Description
Recombinant Human Annexin A4 (ANXA4) is available at Gentaur for Next week Delivery.
Gene Name: ANXA4
Alternative Names : 35-beta calcimedin Annexin IV Annexin-4 Carbohydrate-binding protein p33/p41 Chromobindin-4 Endonexin I Lipocortin IV P32.5 PP4-X Placental anticoagulant protein II
Expression Region : 2-319aa
AA Sequence : ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Theoretical MW : 55.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.
Function : Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.
Involvement in disease :
Subcellular location :
Protein Families : Annexin family
Tissue Specificity :
Paythway :
Uniprot ID : P09525
Euro
British Pound
US Dollar