Recombinant Human Annexin A4 (ANXA4)

Product Description

Recombinant Human Annexin A4 (ANXA4) is available at Gentaur for Next week Delivery.

Gene Name: ANXA4

Alternative Names : 35-beta calcimedin Annexin IV Annexin-4 Carbohydrate-binding protein p33/p41 Chromobindin-4 Endonexin I Lipocortin IV P32.5 PP4-X Placental anticoagulant protein II

Expression Region : 2-319aa

AA Sequence : ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Theoretical MW : 55.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.

Function : Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.

Involvement in disease :

Subcellular location :

Protein Families : Annexin family

Tissue Specificity :

Paythway :

Uniprot ID : P09525