Product Description
Recombinant Human Annexin A5 (ANXA5) is available at Gentaur for Next week Delivery.
Gene Name: ANXA5
Alternative Names : Anchorin CII;Annexin V;Annexin-5;Calphobindin I;CBP-IEndonexin II;Lipocortin V;Placental anticoagulant protein 4;PP4Placental anticoagulant protein I;PAP-I;Thromboplastin inhibitor;Vascular anticoagulant-alpha;VAC-alpha
Expression Region : 2-320aa
AA Sequence : AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
Sequence Info : Full Length of Mature Protein
Tag Info : N-terminal 6xHis-tagged
Theoretical MW : 37.8 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Cardiovascular
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
Function : This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
Involvement in disease : Pregnancy loss, recurrent, 3 (RPRGL3)
Subcellular location :
Protein Families : Annexin family
Tissue Specificity :
Paythway :
Uniprot ID : P08758
 Euro
            
 British Pound
            
 US Dollar