Recombinant Human Annexin A5 (ANXA5)

Product Description

Recombinant Human Annexin A5 (ANXA5) is available at Gentaur for Next week Delivery.

Gene Name: ANXA5

Alternative Names : Anchorin CII;Annexin V;Annexin-5;Calphobindin I;CBP-IEndonexin II;Lipocortin V;Placental anticoagulant protein 4;PP4Placental anticoagulant protein I;PAP-I;Thromboplastin inhibitor;Vascular anticoagulant-alpha;VAC-alpha

Expression Region : 2-320aa

AA Sequence : AQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD

Sequence Info : Full Length of Mature Protein

Tag Info : N-terminal 6xHis-tagged

Theoretical MW : 37.8 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Cardiovascular

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

Function : This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

Involvement in disease : Pregnancy loss, recurrent, 3 (RPRGL3)

Subcellular location :

Protein Families : Annexin family

Tissue Specificity :

Paythway :

Uniprot ID : P08758