Product Description
Recombinant Human Annexin A6 (ANXA6), partial is available at Gentaur for Next week Delivery.
Gene Name: ANX6
Alternative Names : 67KDA calelectrin;Annexin VIAnnexin-6Calphobindin-II;CPB-IIChromobindin-20Lipocortin VIProtein IIIp68p70
Expression Region : 2-245aa
AA Sequence : AKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAV
Sequence Info : Partial
Tag Info : N-terminal GST-tagged
Theoretical MW : 54.4 kDa
Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Endotoxin Level : Not tested-
Biological Activity : Not tested
Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.
Research Area : Signal Transduction
Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.
Relevance : May associate with CD21. May regulate the release of Ca2+ from intracellular stores.
Function : May associate with CD21. May regulate the release of Ca(2+) from intracellular stores.
Involvement in disease :
Subcellular location : Cytoplasm, Melanosome
Protein Families : Annexin family
Tissue Specificity :
Paythway :
Uniprot ID : P08133
Euro
British Pound
US Dollar