Recombinant Human Annexin A6 (ANXA6), partial

Product Description

Recombinant Human Annexin A6 (ANXA6), partial is available at Gentaur for Next week Delivery.

Gene Name: ANX6

Alternative Names : 67KDA calelectrin;Annexin VIAnnexin-6Calphobindin-II;CPB-IIChromobindin-20Lipocortin VIProtein IIIp68p70

Expression Region : 2-245aa

AA Sequence : AKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAV

Sequence Info : Partial

Tag Info : N-terminal GST-tagged

Theoretical MW : 54.4 kDa

Storage Buffer : Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Endotoxin Level : Not tested-

Biological Activity : Not tested

Storage : Short term: -20°C; Long term: -80°C. Minimize freeze and thaw cycles.

Research Area : Signal Transduction

Restriction : For Research Use Only. Not for use in diagnostic procedures, drug use, or for administration to humans or animals.

Relevance : May associate with CD21. May regulate the release of Ca2+ from intracellular stores.

Function : May associate with CD21. May regulate the release of Ca(2+) from intracellular stores.

Involvement in disease :

Subcellular location : Cytoplasm, Melanosome

Protein Families : Annexin family

Tissue Specificity :

Paythway :

Uniprot ID : P08133